General Information

  • ID:  hor000899
  • Uniprot ID:  Q9QXQ6
  • Protein name:  Galanin-like peptide
  • Gene name:  GALP
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Galanin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0009725 response to hormone; GO:0032098 regulation of appetite; GO:0032868 response to insulin; GO:0042595 behavioral response to starvation; GO:0050829 defense response to Gram-negative bacterium; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  APAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMT
  • Length:  60(24-83)
  • Propeptide:  MACSKHLVLFLTILLSLAETPDSAPAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMTKRSMGETFVKPRTGDLRIVDKNVPDEEATLNL
  • Signal peptide:  MACSKHLVLFLTILLSLAETPDS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Involved in a large number of putative physiological functions in CNS homeostatic processes, including the regulation of gonadotropin-releasing hormone secretion
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Galnr2
  • Target Unid:   O08726
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9QXQ6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000899_AF2.pdbhor000899_ESM.pdb

Physical Information

Mass: 755499 Formula: C288H461N87O83S
Absent amino acids: CF Common amino acids: L
pI: 10.7 Basic residues: 10
Polar residues: 20 Hydrophobic residues: 20
Hydrophobicity: -42.5 Boman Index: -9814
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 86.33
Instability Index: 5012.17 Extinction Coefficient cystines: 13980
Absorbance 280nm: 236.95

Literature

  • PubMed ID:  NA
  • Title:  NA